-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-261 of human MMP26 (NP_068573.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MMP26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 90-261 of human MMP26 (NP_068573.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04618A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MMP26 |
| Target Synonyms | MMP26 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 90-261 of human MMP26 (NP_068573.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSISPGRCKWNKHTLTYRIINYPHDMKPSAVKDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSGNPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQLSADDIQRIQHLYGEKCSSDIP | Uniprot ID | Q9NRE1 |
Uniprot Id
Q9NRE1
Target Species
Human
Target Name
MMP26
Target Full Name
Matrix metalloproteinase-26
Target Function
May hydrolyze collagen type IV, fibronectin, fibrinogen, beta-casein, type I gelatin and alpha-1 proteinase inhibitor. Is also able to activate progelatinase B.
Target Subcellular Location
Secreted, extracellular space, extracellular matrix.
Target Protein Families
Peptidase M10A family
Target Tissue Specificity
Expressed specifically in uterus and placenta. Is also widely expressed in malignant tumors from different sources as well as in diverse tumor cell lines.
Target Synonyms
MMP26; Matrix metalloproteinase-26; MMP-26; EC 3.4.24.-; Endometase; Matrilysin-2
Target Background
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature enzyme. This enzyme may degrade collagen type IV, fibronectin, fibrinogen, and beta-casein, and activate matrix metalloproteinase-9 by cleavage. The protein differs from most MMP family members in that it lacks a conserved C-terminal protein domain. The encoded protein may promote cell invasion in multiple human cancers.
Notification