Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MNX1/HB9/HLXB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-315 of human MNX1/HB9/HLXB9 (NP_005506.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MNX1/HB9/HLXB9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 201-315 of human MNX1/HB9/HLXB9 (NP_005506.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07508A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MNX1/HB9/HLXB9 |
| Target Synonyms | HB9; HLXB9; SCRA1; HOXHB9; MNX1/HB9/HLXB9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse thymus, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 201-315 of human MNX1/HB9/HLXB9 (NP_005506.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IKLGAGTFQLDQWLRASTAGMILPKMPDFNSQAQSNLLGKCRRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRSKKAKEQAAQEAEKQKG | Uniprot ID | P50219 |
Uniprot Id
P50219
Target Species
Human
Target Name
MNX1
Target Full Name
Motor neuron and pancreas homeobox protein 1
Target Function
Putative transcription factor involved in pancreas development and function.
Target Involvement
Currarino syndrome (CURRAS)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in lymphoid and pancreatic tissues.
Target Synonyms
HB 9; HB9; HLXB 9; HLXB9; Homeo box HB9; Homeobox HB9; Homeobox protein HB9; HOXHB9; MNX1; MNX1_HUMAN; Motor neuron and pancreas homeobox 1; Motor neuron and pancreas homeobox protein 1; Sacral agenesis autosomal dominant (Currarino triad); SCRA 1; SCRA1
Target Background
This gene encodes a nuclear protein, which contains a homeobox domain and is a transcription factor. Mutations in this gene result in Currarino syndrome, an autosomic dominant congenital malformation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
