Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MOB1A/MOB1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MOB1A/MOB1B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07238A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MOB1A/MOB1B |
| Target Synonyms | MOB1A/MOB1B | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, NIH/3T3, C2C12, Daudi, K-562 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 150-250 of human MOB1A/MOB1B (NP_060691.2/NP_775739.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR/MSFLFGSRSSKTFKPKKNIPEGSHQYELLKHAE | Uniprot ID | Q9H8S9, Q7l9L4 |
Uniprot Id
Q9H8S9, Q7l9L4
Target Synonyms
MOB1A/MOB1B
Target Background
The protein MOB1 is considered to be one of the core components of the mammalian Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. MOB1A and MOB1B, which have 95% sequence identity, play redundant biological roles and are both termed MOB1.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
