-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRE11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-485 of human MRE11 (NP_005582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against MRE11 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 290-485 of human MRE11 (NP_005582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-05880A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRE11 |
| Target Synonyms | ATLD; HNGS1; MRE11A; MRE11B; MRE11 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Jurkat | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 290-485 of human MRE11 (NP_005582.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFL | Uniprot ID | P49959 |
Uniprot Id
P49959
Target Species
Human
Target Name
MRE11
Target Full Name
Double-strand break repair protein MRE11
Target Function
Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis. The complex possesses single-strand endonuclease activity and double-strand-specific 3'-5' exonuclease activity, which are provided by MRE11. RAD50 may be required to bind DNA ends and hold them in close proximity. This could facilitate searches for short or long regions of sequence homology in the recombining DNA templates, and may also stimulate the activity of DNA ligases and/or restrict the nuclease activity of MRE11 to prevent nucleolytic degradation past a given point. The complex may also be required for DNA damage signaling via activation of the ATM kinase. In telomeres the MRN complex may modulate t-loop formation.
Target Involvement
Ataxia-telangiectasia-like disorder 1 (ATLD1)
Target Subcellular Location
Nucleus. Chromosome, telomere. Chromosome.
Target Protein Families
MRE11/RAD32 family
Target Synonyms
AT like disease; Ataxia telangiectasia disorder like; ATLD; DNA recombination and repair protein; Double strand break repair protein MRE11A; Double-strand break repair protein MRE11A; endo/exonuclease Mre11; HNGS1; meiotic recombination (S. cerevisiae) 11 homolog A; Meiotic recombination 11 homolog 1; meiotic recombination 11 homolog A (S. cerevisiae); Meiotic recombination 11 homolog A; MmMRE11A; Mre 11; MRE 11a; MRE 11b; MRE11 homolog 1; MRE11 homolog A; MRE11 homolog double strand break repair nuclease; MRE11 meiotic recombination 11 homolog A (S. cerevisiae); MRE11 meiotic recombination 11 homolog A; MRE11_HUMAN; MRE11A; MRE11b; OTTHUMP00000236830; OTTHUMP00000236831; OTTHUMP00000236832; OTTHUMP00000236833
Target Background
This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.
Notification