-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRP1/ABCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRP1/ABCC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11946A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRP1/ABCC1 |
| Target Synonyms | MRP; ABCC; GS-X; MRP1; ABC29; DFNA77; MRP1/ABCC1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 850-960 of human MRP1/ABCC1 (NP_004987.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWKLMEADKAQTGQVKL | Uniprot ID | P33527 |
Uniprot Id
P33527
Target Species
Human
Target Name
ABCC1
Target Full Name
Multidrug resistance-associated protein 1
Target Function
Mediates export of organic anions and drugs from the cytoplasm. Mediates ATP-dependent transport of glutathione and glutathione conjugates, leukotriene C4, estradiol-17-beta-o-glucuronide, methotrexate, antiviral drugs and other xenobiotics. Confers resistance to anticancer drugs by decreasing accumulation of drug in cells, and by mediating ATP- and GSH-dependent drug export. Hydrolyzes ATP with low efficiency. Catalyzes the export of sphingosine 1-phosphate from mast cells independently of their degranulation. Participates in inflammatory response by allowing export of leukotriene C4 from leukotriene C4-synthezing cells.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
ABC transporter superfamily, ABCC family, Conjugate transporter (TC 3.A.1.208) subfamily
Target Tissue Specificity
Lung, testis and peripheral blood mononuclear cells.
Target Research Area
Signal Transduction
Target Synonyms
ABC 29; ABC29; ABCC 1; ABCC; Abcc1; ATP binding cassette sub family C (CFTR/MRP) member 1; ATP binding cassette sub-family C member 1; ATP binding cassette subfamily C member 1; ATP binding cassette transporter variant ABCC1delta ex13; ATP binding cassette transporter variant ABCC1delta ex13&14; ATP binding cassette transporter variant ABCC1delta ex25; ATP binding cassette transporter variant ABCC1delta ex25&26; ATP binding cassette, sub-family C (CFTR/MRP), member 1; ATP-binding cassette sub-family C member 1; DKFZp686N04233; DKFZp781G125; GS X; GSX; Leukotriene C(4) transporter; LTC4 transporter; MRP 1; MRP; MRP1; MRP1_HUMAN; Multidrug resistance associated protein 1; Multidrug resistance protein; Multidrug resistance-associated protein 1; Multiple drug resistance associated protein; Multiple drug resistance protein 1
Target Background
The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.
Notification