Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL21 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPL21(NP_852615.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MRPL21 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPL21(NP_852615.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-08326A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL21 |
| Target Synonyms | MRPL21; L21mt; MRP-L21; mitochondrial ribosomal protein L21 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 40-140 of human MRPL21(NP_852615.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVVKKVNEMIVTGQYGRLFAVVHFASRQWKVTSEDLILIGNELDLACGERIRLEKVLLVGADN | Uniprot ID | Q7Z2W9 |
Uniprot Id
Q7Z2W9
Target Species
Human
Target Name
MRPL21
Target Full Name
Large ribosomal subunit protein bL21m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bL21 family
Target Synonyms
MRPL21; 39S ribosomal protein L21; mitochondrial; L21mt; MRP-L21; Mitochondrial large ribosomal subunit protein bL21m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding different isoforms were identified through sequence analysis although some may be subject to nonsense-mediated decay (NMD).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
