Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-206 of human MRPL22(NP_054899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPL22 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 59-206 of human MRPL22(NP_054899.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08327A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL22 |
| Target Synonyms | MRPL22; HSPC158; L22mt; MRP-L22; MRP-L25; RPML25; mitochondrial ribosomal protein L22 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 59-206 of human MRPL22(NP_054899.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GEPRRPAEIYHCRRQIKYSKDKMWYLAKLIRGMSIDQALAQLEFNDKKGAKIIKEVLLEAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL | Uniprot ID | Q9NWU5 |
Uniprot Id
Q9NWU5
Target Species
Human
Target Name
MRPL22
Target Full Name
Large ribosomal subunit protein uL22m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uL22 family
Target Synonyms
MRPL22; MRPL25; RPML25; HSPC15839S ribosomal protein L22; mitochondrial; L22mt; MRP-L22; 39S ribosomal protein L25; mitochondrial; L25mt; MRP-L25; Mitochondrial large ribosomal subunit protein uL22m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the L22 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 4q. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
