Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human MRPL23 (NP_066957.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MRPL23 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human MRPL23 (NP_066957.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-00295A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL23 |
| Target Synonyms | RPL23; L23MRP; RPL23L; MRPL23 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat heart, A-549, Mouse brain, Mouse liver, Mouse lung, Rat kidney, Rat liver, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-153 of human MRPL23 (NP_066957.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARNVVYPLYRLGGPQLRVFRTNFFIQLVRPGVAQPEDTVQFRIPMEMTRVDLRNYLEGIYNVPVAAVRTRVQHGSNKRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL | Uniprot ID | Q16540 |
Uniprot Id
Q16540
Target Species
Human
Target Name
MRPL23
Target Full Name
Large ribosomal subunit protein uL23m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Universal ribosomal protein uL23 family
Target Synonyms
L23MRP; 39S ribosomal protein L23; 39S ribosomal protein L23; mitochondrial; L23 mitochondrial-related protein; L23mt; mitochondrial; Mitochondrial ribosomal protein L23; MRP-L23; MRPL23; Ribosomal protein L23-like; Ribosomal protein related to L23 (mitochondrial); RM23_HUMAN; RPL23; RPL23L
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. The gene is biallelically expressed, despite its location within a region of imprinted genes on chromosome 11.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
