-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against MRPL28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14449A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL28 |
| Target Synonyms | p15; MAAT1; MRPL28 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Rat heart, 293T, K-562, Rat kidney, Ratpancreas | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MRPL28 (NP_006419.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIYFPPESQRGLWGGEGWILGQIYANNDKLSKR | Uniprot ID | Q13084 |
Uniprot Id
Q13084
Target Species
Human
Target Name
MRPL28
Target Full Name
Large ribosomal subunit protein bL28m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bL28 family
Target Tissue Specificity
Found in a variety of normal tissues including spleen, testes, thymus, liver, kidney, brain, adrenal, lung and retinal tissue.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
39S ribosomal protein L28; 39S ribosomal protein L28 mitochondrial; 39S ribosomal protein L28 mitochondrial precursor ; HGNC6756 ; L28mt; MAAT 1; MAAT1; Melanoma antigen p15; Melanoma associated antigen recognised by cytotoxic T lymphocytes; Melanoma associated antigen recognized by T lymphocytes; Melanoma-associated antigen recognized by T-lymphocytes; MGC8499; mitochondrial; Mitochondrial ribosomal protein L28; MRP L28; MRP-L28; MRPL 28; mrpl28; P15 ; RM28_HUMAN
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein, a part of which was originally isolated by its ability to recognize tyrosinase in an HLA-A24-restricted fashion.
Notification