Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL51 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL51 (NP_057581.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPL51 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL51 (NP_057581.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04798A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL51 |
| Target Synonyms | CDA09; MRP64; bMRP64; HSPC241; MRPL51 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, Rat kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL51 (NP_057581.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNRHGKFR | Uniprot ID | Q4U2R6 |
Uniprot Id
Q4U2R6
Target Species
Human
Target Name
MRPL51
Target Full Name
Large ribosomal subunit protein mL51
Target Subcellular Location
Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mL51 family
Target Synonyms
39S ribosomal protein L51; 39S ribosomal protein L51 mitochondrial; bMRP-64; bMRP64; CDA09; HSPC241; L51mt; mitochondrial; mitochondrial ribosomal protein 64; mitochondrial ribosomal protein bMRP64; mitochondrial ribosomal protein L51 ; MRP-L51; MRP64; mrpl51; RM51_HUMAN
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
