Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPL55 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL55 (NP_001308213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPL55 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL55 (NP_001308213.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07237A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPL55 |
| Target Synonyms | L55nt; MRP-L55; AAVG5835; PRO19675; MRPL55 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human MRPL55 (NP_001308213.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAVGSLLGRLRQSTVKATGPALRRLHTSSWRADSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK | Uniprot ID | Q7Z7F7 |
Uniprot Id
Q7Z7F7
Target Species
Human
Target Name
MRPL55
Target Full Name
Large ribosomal subunit protein mL55
Target Subcellular Location
Mitochondrion.
Target Protein Families
Mitochondrion-specific ribosomal protein mL55 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
39S ribosomal protein L55; 39S ribosomal protein L55; mitochondrial; AAVG5835; DKFZp686D1387; L55mt; L55nt; MGC61802; mitochondrial; Mitochondrial ribosomal protein L55; MRP L55; MRP-L55; MRPL55; PRO19675; RM55_HUMAN
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. Multiple transcript variants encoding two different isoforms were identified through sequence analysis.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
