-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPS16 (NP_057149.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MRPS16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPS16 (NP_057149.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08900A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS16 |
| Target Synonyms | S16mt; COXPD2; RPMS16; CGI-132; MRP-S16; MRPS16 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse kidney, Rat brain, HT-1080, Jurkat, MCF7, Mouse liver, SW620 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human MRPS16 (NP_057149.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLHPMMITNAERLRRKRAREVLLASQKTDAEATDTEATET | Uniprot ID | Q9Y3D3 |
Uniprot Id
Q9Y3D3
Target Species
Human
Target Name
MRPS16
Target Full Name
Small ribosomal subunit protein bS16m
Target Involvement
Combined oxidative phosphorylation deficiency 2 (COXPD2)
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bS16 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
28S ribosomal protein S16; 28S ribosomal protein S16 mitochondrial; CGI-132; COXPD2; mitochondrial; Mitochondrial ribosomal protein S16; MRP-S16; mrps16; RPMS16; RT16_HUMAN; S16mt
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S16P family. The encoded protein is one of the most highly conserved ribosomal proteins between mammalian and yeast mitochondria. Three pseudogenes (located at 8q21.3, 20q13.32, 22q12-q13.1) for this gene have been described.
Notification