-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS18A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 97-196 of human MRPS18A(NP_060605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MRPS18A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 97-196 of human MRPS18A(NP_060605.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08317A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS18A |
| Target Synonyms | mL66; S18bmt; S18mt-a; MRPS18-3; HumanS18b; MRP-S18-3; MRP-S18-a; MRPS18A | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 97-196 of human MRPS18A(NP_060605.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH | Uniprot ID | Q9NVS2 |
Uniprot Id
Q9NVS2
Target Species
Human
Target Name
MRPS18A
Target Full Name
Large ribosomal subunit protein mL66
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bS18 family, Mitochondrion-specific ribosomal protein mL66 subfamily
Target Synonyms
MRPS18A; 39S ribosomal protein S18a; mitochondrial; MRP-S18-a; Mrps18a; S18mt-a; 39S ribosomal protein S18-3; mitochondrial; MRP-S18-3; Mitochondrial large ribosomal subunit protein bS18a; Mitochondrial large ribosomal subunit protein mL66
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. A pseudogene corresponding to this gene is found on chromosome 3p. Alternative splicing results in multiple transcript variants.
Notification