Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MRPS21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human MRPS21(NP_114107.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against MRPS21 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human MRPS21(NP_114107.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of?MRPS21 in paraffin-embedded?mouse kidney tissue using?MRPS21 Rabbit pAb at a dilution of 1:200 (40x lens).?High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Cat.No | ADA-08486A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MRPS21 |
| Target Synonyms | bS21m; MDS016; RPMS21; MRP-S21 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-87 of human MRPS21(NP_114107.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAKHLKFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCCRRQRESYERCRRIYNMEMARKINFLMRKNRADPWQGC | Uniprot ID | P82921 |
Uniprot Id
P82921
Target Species
Human
Target Name
MRPS21
Target Full Name
Small ribosomal subunit protein bS21m
Target Subcellular Location
Mitochondrion.
Target Protein Families
Bacterial ribosomal protein bS21 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
MRPS21; RPMS21; MDS01628S ribosomal protein S21; mitochondrial; MRP-S21; S21mt; Mitochondrial small ribosomal subunit protein bS21m
Target Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S21P family. Pseudogenes corresponding to this gene are found on chromosomes 1p, 1q, 9p, 10p, 10q, 16q, and 17q. Available sequence data analyses identified splice variants that differ in the 5' UTR; both transcripts encode the same protein.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
