Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MS4A8B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MS4A8B was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01429A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MS4A8B |
| Target Synonyms | MS4A4; 4SPAN4; CD20L5; MS4A8B | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC | Uniprot ID | Q9BY19 |
Uniprot Id
Q9BY19
Target Species
Human
Target Name
MS4A8
Target Full Name
Membrane-spanning 4-domains subfamily A member 8
Target Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Target Subcellular Location
Membrane; Multi-pass membrane protein.
Target Protein Families
MS4A family
Target Tissue Specificity
Expressed by hematopoietic tissues and cells lines.
Target Synonyms
MS4A8; 4SPAN4; MS4A8B; Membrane-spanning 4-domains subfamily A member 8; Four-span transmembrane protein 4; Membrane-spanning 4-domains subfamily A member 8B
Target Background
This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.3, among a cluster of family members.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
