Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MSL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07148A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSL1 |
| Target Synonyms | MSL-1; MSL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, K-562, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-300 of human MSL1 (NP_001012241). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LAVPSWRDHSVEPLRDPNPSDLLENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRMYKKKGIQESEPEVTSFFPEPDDVES | Uniprot ID | Q68DK7 |
Uniprot Id
Q68DK7
Target Species
Human
Target Name
MSL1
Target Full Name
Male-specific lethal 1 homolog
Target Function
Component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at 'Lys-16' (H4K16ac) which is implicated in the formation of higher-order chromatin structure. Greatly enhances MSL2 E3 ubiquitin ligase activity, promoting monoubiquitination of histone H2B at 'Lys-34' (H2BK34Ub). This modification in turn stimulates histone H3 methylation at 'Lys-4' (H3K4me) and 'Lys-79' (H3K79me) and leads to gene activation, including that of HOXA9 and MEIS1. In the MSL complex, acts as a scaffold to tether MSL3 and KAT8 together for enzymatic activity regulation.
Target Subcellular Location
Nucleus. Nucleus, nucleoplasm. Nucleus speckle.
Target Protein Families
Msl-1 family
Target Synonyms
hMSL1; male specific lethal 1; male specific lethal 1 homolog 1; male specific lethal 1 homolog; male specific lethal 1 like 1; Male-specific lethal 1 homolog; Male-specific lethal 1-like 1; Male-specific lethal-1 homolog 1; MSL 1; MSL-1; Msl1; MSL1 like 1; MSL1-like 1; MSL1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
