-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSMB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-114 of human MSMB (NP_002434.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MSMB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 30-114 of human MSMB (NP_002434.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08985A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSMB |
| Target Synonyms | MSP; PSP; IGBF; MSPB; PN44; PRPS; HPC13; PSP57; PSP94; PSP-94; MSMB | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 30-114 of human MSMB (NP_002434.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII | Uniprot ID | P08118 |
Uniprot Id
P08118
Target Species
Human
Target Name
MSMB
Target Full Name
Beta-microseminoprotein
Target Involvement
Prostate cancer, hereditary, 13 (HPC13)
Target Subcellular Location
Secreted. Note=Sperm surface.
Target Protein Families
Beta-microseminoprotein family
Target Tissue Specificity
Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney an
Target Synonyms
Beta microseminoprotein [Precursor] ; Beta-microseminoprotein; HPC 13; HPC13; IGBF; Immunoglobulin binding factor; Immunoglobulin-binding factor; microseminoprotein beta; Msmb; MSMB_HUMAN; MSP; MSPB; PN 44; PN44; Prostate secreted seminal plasma protein; Prostate secretory protein of 94 amino acids; Prostate secretory protein PSP94; PRPS; PRSP; PSP 57; PSP; PSP-94; PSP57; PSP94; Seminal plasma beta inhibin ; Seminal plasma beta-inhibin
Target Background
The protein encoded by this gene is a member of the immunoglobulin binding factor family. It is synthesized by the epithelial cells of the prostate gland and secreted into the seminal plasma. This protein has inhibin-like activity. It may have a role as an autocrine paracrine factor in uterine, breast and other female reproductive tissues. The expression of the encoded protein is found to be decreased in prostate cancer. Two alternatively spliced transcript variants encoding different isoforms are described for this gene. The use of alternate polyadenylation sites has been found for this gene.
Notification