Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSRB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human MSRB3 (NP_001026849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MSRB3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human MSRB3 (NP_001026849.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08571A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSRB3 |
| Target Synonyms | DFNB74; MSRB3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse lung, Mouse testis, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-185 of human MSRB3 (NP_001026849.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL | Uniprot ID | Q8IXL7 |
Uniprot Id
Q8IXL7
Target Species
Human
Target Name
MSRB3
Target Full Name
Methionine-R-sulfoxide reductase B3
Target Function
Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing.
Target Involvement
Deafness, autosomal recessive, 74 (DFNB74)
Target Subcellular Location
[Isoform 1]: Endoplasmic reticulum.; [Isoform 2]: Mitochondrion.
Target Protein Families
MsrB Met sulfoxide reductase family
Target Tissue Specificity
Widely expressed.
Target Research Area
Signal Transduction
Target Synonyms
Deafness, Autosomal Recessive 74; DFNB74; FLJ36866; Methionine R sulfoxide reductase B mitochondrial; Methionine sulfoxide reductase B3; Methionine-R-sulfoxide reductase B3; MsrB3; MSRB3_HUMAN
Target Background
The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
