-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MST4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 317-416 of human MST4 (Q9P289) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MST4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 317-416 of human MST4 (Q9P289) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13277A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MST4 |
| Target Synonyms | MASK; MST4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF7, Mouse thymus, Rat thymus | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 317-416 of human MST4 (Q9P289). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENNTHPEWSFTTVRKKPDPKKVQNGAEQDLVQTLSCLSMIITPAFAELKQQDENNASRNQAIEELEKSIAVAEAACPGITDKMVKKLIEKFQKCSADESP | Uniprot ID | Q9P289 |
Uniprot Id
Q9P289
Target Species
Human
Target Name
STK26
Target Full Name
Serine/threonine-protein kinase 26
Target Function
Mediator of cell growth. Modulates apoptosis. In association with STK24 negatively regulates Golgi reorientation in polarized cell migration upon RHO activation.
Target Subcellular Location
Cytoplasm. Golgi apparatus.
Target Protein Families
Protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily
Target Synonyms
2610018G03Rik; EC 2.7.11.1; Mammalian Ste20 like protein kinase 4; Mammalian STE20-like protein kinase 4; Mammalian sterile 20 like 4; MASK; MST 4; MST-4; MST3 and SOK1 related kinase; Mst3 and SOK1-related kinase; Mst4; MST4_HUMAN; RGD1563568; RP23-245F8.1; RP6 213H19.1; Serine/threonine protein kinase 26; Serine/threonine protein kinase MASK; Serine/threonine protein kinase MST 4; Serine/threonine protein kinase MST4; Serine/threonine-protein kinase MASK; Serine/threonine-protein kinase MST4; STE20 like kinase MST 4; STE20 like kinase MST4; STE20-like kinase MST4; STK26
Target Background
The product of this gene is a member of the GCK group III family of kinases, which are a subset of the Ste20-like kinases. The encoded protein contains an amino-terminal kinase domain, and a carboxy-terminal regulatory domain that mediates homodimerization. The protein kinase localizes to the Golgi apparatus and is specifically activated by binding to the Golgi matrix protein GM130. It is also cleaved by caspase-3 in vitro, and may function in the apoptotic pathway. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.
Notification