Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-ATP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-68 of human MT-ATP8 (YP_003024030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MT-ATP8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-68 of human MT-ATP8 (YP_003024030.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12390A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-ATP8 |
| Target Synonyms | ATPase8; MTATP8; ATP8; MT-ATP8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293F, A-549, HepG2 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-68 of human MT-ATP8 (YP_003024030.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNKPWEPKWTKICSLHSLPPQS | Uniprot ID | P03928 |
Uniprot Id
P03928
Target Species
Human
Target Name
MT-ATP8
Target Full Name
ATP synthase protein 8
Target Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane
Target Involvement
Mitochondrial complex V deficiency, mitochondrial 2 (MC5DM2); Cardiomyopathy, infantile hypertrophic (CMHI)
Target Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.
Target Protein Families
ATPase protein 8 family
Target Synonyms
MT-ATP8; ATP8; ATPASE8; MTATP8; ATP synthase protein 8; A6L; F-ATPase subunit 8
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
