Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-CYB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MT-CYB (YP_003024038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MT-CYB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human MT-CYB (YP_003024038.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12674A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-CYB |
| Target Synonyms | MTCYB; CYTB; MT-CYB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MT-CYB (YP_003024038.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFL | Uniprot ID | P00156 |
Uniprot Id
P00156
Target Species
Human
Target Name
MT-CYB
Target Full Name
Cytochrome b
Target Function
Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) that is part of the mitochondrial respiratory chain. The b-c1 complex mediates electron transfer from ubiquinol to cytochrome c. Contributes to the generation of a proton gradient across the mitochondrial membrane that is then used for ATP synthesis.
Target Involvement
Cardiomyopathy, infantile histiocytoid (CMIH); Leber hereditary optic neuropathy (LHON)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Cytochrome b family
Target Synonyms
COB; Complex III subunit 3; Complex III subunit III; CYB_HUMAN; CYTB; Cytochrome b; Cytochrome b c1 complex subunit 3; Cytochrome b-c1 complex subunit 3; Mitochondrially encoded cytochrome b; MT-CYB; MTCYB; Ubiquinol cytochrome c reductase complex cytochrome b subunit; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit
Target Background
Predicted to enable metal ion binding activity. Predicted to be involved in several processes, including electron transport coupled proton transport; response to cobalamin; and response to glucagon. Located in mitochondrion. Implicated in ovarian carcinoma and urinary bladder cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
