Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MT-ND4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 401-459 of human MT-ND4 (YP_002124311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MT-ND4 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 401-459 of human MT-ND4 (YP_002124311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10537A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MT-ND4 |
| Target Synonyms | MTND4; ND4; MT-ND4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SGC-7901, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 401-459 of human MT-ND4 (YP_002124311.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS | Uniprot ID | P03905 |
Uniprot Id
P03905
Target Species
Human
Target Name
MT-ND4
Target Full Name
NADH-ubiquinone oxidoreductase chain 4
Target Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Essential for the catalytic activity and assembly of complex I.
Target Involvement
Leber hereditary optic neuropathy (LHON); Leber hereditary optic neuropathy with dystonia (LDYT); Mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS)
Target Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Target Protein Families
Complex I subunit 4 family
Target Synonyms
MT-ND4; MTND4; NADH dehydrogenase subunit 4; NADH-ubiquinone oxidoreductase chain 4; NADH4; ND4; NU4M_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
