-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MTF2 (NP_001157864.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MTF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MTF2 (NP_001157864.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02698A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTF2 |
| Target Synonyms | M96; PCL2; TDRD19A; dJ976O13.2; MTF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, HepG2, HL-60, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human MTF2 (NP_001157864.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLE | Uniprot ID | Q9Y483 |
Uniprot Id
Q9Y483
Target Species
Human
Target Name
MTF2
Target Full Name
Metal-response element-binding transcription factor 2
Target Function
Polycomb group (PcG) protein that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex, thus enhancing PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter.
Target Subcellular Location
Nucleus.
Target Protein Families
Polycomblike family
Target Synonyms
MTF2; PCL2; Metal-response element-binding transcription factor 2; Metal regulatory transcription factor 2; Metal-response element DNA-binding protein M96; Polycomb-like protein 2; hPCl2
Target Background
Enables methylated histone binding activity and transcription corepressor binding activity. Predicted to be involved in several processes, including regulation of histone H3-K27 methylation; regulation of transcription by RNA polymerase II; and segment specification. Predicted to act upstream of or within cellular response to leukemia inhibitory factor. Located in cytoplasm; focal adhesion; and nucleoplasm.
Notification