Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MTMR14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 335-500 of human MTMR14 (NP_001070993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MTMR14 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 335-500 of human MTMR14 (NP_001070993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02482A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MTMR14 |
| Target Synonyms | C3orf29; MTMR14 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 335-500 of human MTMR14 (NP_001070993.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRTPLFISLLRLSLWADGLIHTSLKPTEILYLTVAYDWFLFGHMLVDRLSKGEEIFFFCFNFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGSDFSLVMESSPGATGSFTYEAVELVPAGAPTQAAWRKSHSSSPQSVLWNRPQPSEDR | Uniprot ID | Q8NCE2 |
Uniprot Id
Q8NCE2
Target Species
Human
Target Name
MTMR14
Target Full Name
Phosphatidylinositol-3,5-bisphosphate 3-phosphatase MTMR14
Target Function
Lipid phosphatase which efficiently dephosphorylates phosphatidylinositol 3-phosphate (PtdIns3P) and PtdIns(3,5)P2; inactive toward PtdIns4P, PtdIns(3,4)P2, PtdIns(4,5)P2 and PtdIns(3,4,5)P3.
Target Involvement
Myopathy, centronuclear, 1 (CNM1)
Target Subcellular Location
Cytoplasm. Note=Found in reticular structures and plasma membrane ruffles. Concentrated near the nucleus.
Target Protein Families
Protein-tyrosine phosphatase family, Non-receptor class myotubularin subfamily
Target Tissue Specificity
Expressed in various tissues, including heart, skeletal muscle, placenta, liver, lung, kidney and pancreas.
Target Synonyms
C3orf29; Egg derived tyrosine phosphatase homolog; FLJ11546; FLJ22405; FLJ46453; FLJ90311; HCV NS5A transactivated protein 4 splice variant A binding protein 1; HCV NS5A-transactivated protein 4 splice variant A-binding protein 1; hEDTP; hJumpy; jumpy; MTMR 14; MTMR14; MTMRE_HUMAN; Myotubularin related protein 14; Myotubularin-related protein 14; NS5ATP4ABP1
Target Background
This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3, 5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
