-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MUC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MUC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13189A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MUC4 |
| Target Synonyms | ASGP; MUC-4; HSA276359; MUC4 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 4807-4916 of human MUC4 (Q99102). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WATVSVIALSNILHASASLPPEYQNRTEGLLGVWNNNPEDDFRMPNGSTIPPGSPEEMLFHFGMTWQINGTGLLGKRNDQLPSNFTPVFYSQLQKNSSWAEHLISNCDGD | Uniprot ID | Q99102 |
Uniprot Id
Q99102
Target Species
Human
Target Name
MUC4
Target Full Name
Mucin-4
Target Function
Membrane-bound mucin, a family of highly glycosylated proteins that constitute the major component of the mucus, the slimy and viscous secretion covering epithelial surfaces. These glycoproteins play important roles in the protection of the epithelium and are implicated in epithelial renewal and differentiation. Regulates cellular behavior through both anti-adhesive effects on cell-cell and cell-extracellular matrix interactions and its ability to act as an intramembrane ligand for ERBB2. Plays an important role in proliferation and differentiation of epithelial cells by inducing specific phosphorylation of ERBB2. In polarized epithelial cells, segregates ERBB2 and other ERBB receptors and prevents ERBB2 from acting as a coreceptor. The interaction with ERBB2 leads to enhanced expression of CDKN1B. The formation of a MUC4-ERBB2-ERBB3-NRG1 complex leads to down-regulation of CDKN1B, resulting in repression of apoptosis and stimulation of proliferation. Its ability to promote tumor growth may be mainly due to repression of apoptosis as opposed to proliferation
Target Subcellular Location
[Mucin-4 beta chain]: Cell membrane; Single-pass membrane protein.; [Mucin-4 alpha chain]: Cell membrane. Secreted.; [Isoform 3]: Cell membrane; Single-pass membrane protein.; [Isoform 11]: Secreted.; [Isoform 15]: Secreted.; [Isoform 17]: Cell membrane; Single-pass membrane protein.
Target Tissue Specificity
Expressed in the thymus, thyroid, lung, trachea, esophagus, stomach, small intestine, colon, testis, prostate, ovary, uterus, placenta, and mammary and salivary glands. Expressed in carcinomas arising from some of these epithelia, such as lung cancers, sq
Target Synonyms
Ascites sialoglycoprotein 1; Ascites sialoglycoprotein 2; Ascites sialoglycoprotein; ASGP; ASGP-1; ASGP-2; HSA276359; MUC 4; MUC-4; Muc4; MUC4_HUMAN; Mucin 4; Mucin 4 cell surface associated; Mucin 4 tracheobronchial; Mucin-4 beta chain; Pancreatic adenocarcinoma mucin; Testis mucin; Tracheobronchial mucin; Tracheobronchial mucin Fragment
Target Background
The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.
Notification