-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Musashi-2 (MSI2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (MSI2) (Q96DH6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Musashi-2 (MSI2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (MSI2) (Q96DH6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14281A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Musashi-2 (MSI2) |
| Target Synonyms | MSI2H; Musashi-2 (MSI2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, HT-29, MCF7, Mouse brain, PC-12 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Musashi-2 (MSI2) (Q96DH6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYIS | Uniprot ID | Q96DH6 |
Uniprot Id
Q96DH6
Target Species
Human
Target Name
MSI2
Target Full Name
RNA-binding protein Musashi homolog 2
Target Function
RNA binding protein that regulates the expression of target mRNAs at the translation level. May play a role in the proliferation and maintenance of stem cells in the central nervous system.
Target Involvement
Chromosomal aberrations involving MSI2 may contribute to disease progression in chronic myeloid leukemia. Translocation t(7;17)(p15;q23) with HOXA9; translocation t(7;17)(q32-34;q23).
Target Subcellular Location
Cytoplasm.
Target Protein Families
Musashi family
Target Tissue Specificity
Ubiquitous; detected at low levels.
Target Synonyms
FLJ36569; MGC3245; Msi2; MSI2/HOXA9 fusion gene, included; MSI2H; MSI2H_HUMAN; Musashi 2; Musashi homolog 2; Musashi RNA binding protein 2; Musashi, Drosophila, homolog of, 2; Musashi-2; RNA binding protein Musashi homolog 2; RNA-binding protein Musashi homolog 2; WD 40 repeat protein MSI2
Target Background
This gene encodes an RNA-binding protein that is a member of the Musashi protein family. The encoded protein is transcriptional regulator that targets genes involved in development and cell cycle regulation. Mutations in this gene are associated with poor prognosis in certain types of cancers. This gene has also been shown to be rearranged in certain cancer cells.
Notification