-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MVP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MVP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14101A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MVP |
| Target Synonyms | LRP; VAULT1; MVP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, HT-29, Mouse liver, Mouse lung, Rat kidney, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MVP (Q14764). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQGLVLFDVTGQVRLRHADLEIRLAQDPFPLY | Uniprot ID | Q14764 |
Uniprot Id
Q14764
Target Species
Human
Target Name
MVP
Target Full Name
Major vault protein
Target Function
Required for normal vault structure. Vaults are multi-subunit structures that may act as scaffolds for proteins involved in signal transduction. Vaults may also play a role in nucleo-cytoplasmic transport. Down-regulates IFNG-mediated STAT1 signaling and subsequent activation of JAK. Down-regulates SRC activity and signaling through MAP kinases.
Target Subcellular Location
Cytoplasm. Nucleus, nuclear pore complex. Cytoplasm, perinuclear region. Note=5% found in the nuclear pore complex (PubMed:15133037). Translocates from the nucleus to the cytoplasm upon EGF treatment (PubMed:16441665).
Target Tissue Specificity
Present in most normal tissues. Higher expression observed in epithelial cells with secretory and excretory functions, as well as in cells chronically exposed to xenobiotics, such as bronchial cells and cells lining the intestine. Overexpressed in many mu
Target Research Area
Transport
Target Synonyms
LRP; Lung resistance related protein; Lung resistance-related protein; Major vault protein; Major vault protein; rat; homolog of; MVP; MVP_HUMAN; testicular secretory protein Li 30; VAULT 1; VAULT1
Target Background
This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene.
Notification