-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human MX1 (NP_001171517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MX1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human MX1 (NP_001171517.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-11334A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MX1 |
| Target Synonyms | MX; MxA; IFI78; IFI-78K; lncMX1-215; MX1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human MX1 (NP_001171517.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK | Uniprot ID | P20591 |
Uniprot Id
P20591
Target Species
Human
Target Name
MX1
Target Full Name
Interferon-induced GTP-binding protein Mx1
Target Function
Interferon-induced dynamin-like GTPase with antiviral activity against a wide range of RNA viruses and some DNA viruses. Its target viruses include negative-stranded RNA viruses and HBV through binding and inactivation of their ribonucleocapsid. May also antagonize reoviridae and asfarviridae replication. Inhibits thogoto virus (THOV) replication by preventing the nuclear import of viral nucleocapsids. Inhibits La Crosse virus (LACV) replication by sequestering viral nucleoprotein in perinuclear complexes, preventing genome amplification, budding, and egress. Inhibits influenza A virus (IAV) replication by decreasing or delaying NP synthesis and by blocking endocytic traffic of incoming virus particles. Enhances ER stress-mediated cell death after influenza virus infection. May regulate the calcium channel activity of TRPCs.
Target Subcellular Location
Cytoplasm. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, perinuclear region.; [Isoform 2]: Cytoplasm. Nucleus.
Target Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Target Synonyms
Human interferon regulated resistance GTP binding protein MXA; IFI 78; IFI 78K; IFI-78K; IFI78; IFI78K; Interferon induced GTP binding protein Mx1 ; Interferon induced protein p78; Interferon inducible protein p78; Interferon regulated resistance GTP binding protein; Interferon regulated resistance GTP binding protein MxA; Interferon-induced GTP-binding protein Mx1; Interferon-induced protein p78; Interferon-regulated resistance GTP-binding protein MxA; MX 1; MX; MX dynamin-like GTPase 1; MX1; MX1_HUMAN; MxA; Myxoma resistance protein 1; Myxovirus (influenza virus) resistance 1 interferon inducible; Myxovirus (influenza virus) resistance 1 interferon inducible protein p78; Myxovirus (influenza) resistance 1 homolog of murine; Myxovirus resistance 1; mouse; homolog of; Myxovirus resistance protein 1; N-terminally processed
Target Background
This gene encodes a guanosine triphosphate (GTP)-metabolizing protein that participates in the cellular antiviral response. The encoded protein is induced by type I and type II interferons and antagonizes the replication process of several different RNA and DNA viruses. There is a related gene located adjacent to this gene on chromosome 21, and there are multiple pseudogenes located in a cluster on chromosome 4. Alternative splicing results in multiple transcript variants.
Notification