Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MXD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MXD4 (NP_006445.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MXD4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MXD4 (NP_006445.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00261A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MXD4 |
| Target Synonyms | MAD4; MST149; MSTP149; bHLHc12; MXD4 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-209 of human MXD4 (NP_006445.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRALSIKEQLQQEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDADDHYSLQSGTGGDSGFGPHCRRLGRPALS | Uniprot ID | Q14582 |
Uniprot Id
Q14582
Target Species
Human
Target Name
MXD4
Target Full Name
Max dimerization protein 4
Target Function
Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Target Subcellular Location
Nucleus.
Target Synonyms
bHLHc12; Class C basic helix loop helix protein 12; Class C basic helix-loop-helix protein 12; MAD 4; MAD4; Mad4 homolog; MAD4_HUMAN; Max associated protein 4; MAX dimerization protein 4; Max dimerizer 4; Max interacting transcriptional repressor MAD4; Max-associated protein 4; Max-interacting transcriptional repressor MAD4; MST 149; MST149; MSTP 149; MSTP149; MXD 4; MXD4
Target Background
This gene is a member of the MAD gene family . The MAD genes encode basic helix-loop-helix-leucine zipper proteins that heterodimerize with MAX protein, forming a transcriptional repression complex. The MAD proteins compete for MAX binding with MYC, which heterodimerizes with MAX forming a transcriptional activation complex. Studies in rodents suggest that the MAD genes are tumor suppressors and contribute to the regulation of cell growth in differentiating tissues.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
