-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYCBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MYCBP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03919A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYCBP |
| Target Synonyms | AMY-1; MYCBP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, K-562 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human MYCBP (NP_036465.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE | Uniprot ID | Q99417 |
Uniprot Id
Q99417
Target Species
Human
Target Name
MYCBP
Target Full Name
c-Myc-binding protein
Target Function
May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.
Target Subcellular Location
Cytoplasm. Nucleus. Mitochondrion. Note=Translocates into the nucleus in the S phase of the cell cycle upon an increase of MYC expression. Found in the mitochondria when associated with AKAP1.
Target Protein Families
AMY1 family
Target Tissue Specificity
Highly expressed in heart, placenta, pancreas, skeletal muscle and kidney. Also present at low levels in lung.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
AMY 1; AMY-1; AMY1; Associate of Myc 1; C myc binding protein ; C-Myc-binding protein; Cmyc binding protein; MYCBP; MYCBP_HUMAN
Target Background
The protein encoded by this gene binds to the N-terminus of the oncogenic protein C-MYC, enhancing the ability of C-MYC to activate E box-dependent transcription. The encoded protein is normally found in the cytoplasm, but it translocates to the nucleus during S phase of the cell cycle and associates with C-MYC. This protein may be involved in spermatogenesis. This gene can be silenced by microRNA-22. Two transcript variants, one protein-coding and the other probably not protein-coding, have been found for this gene.
Notification