Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYCT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-235 of human MYCT1 (NP_079383.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYCT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 99-235 of human MYCT1 (NP_079383.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-10202A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYCT1 |
| Target Synonyms | MTLC; MYCT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 99-235 of human MYCT1 (NP_079383.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ASAPISQWSSSRRSRSSYTHGLNRTGFYRHSGCERRSNLSLASLTFQRQASLEQANSFPRKSSFRASTFHPFLQCPPLPVETESQLVTLPSSNISPTISTSHSLSRPDYWSSNSLRVGLSTPPPPAYESIIKAFPDS | Uniprot ID | Q8N699 |
Uniprot Id
Q8N699
Target Species
Human
Target Name
MYCT1
Target Full Name
Myc target protein 1
Target Function
May regulate certain MYC target genes, MYC seems to be a direct upstream transcriptional activator. Does not seem to significantly affect growth cell capacity. Overexpression seems to mediate many of the known phenotypic features associated with MYC, including promotion of apoptosis, alteration of morphology, enhancement of anchorage-independent growth, tumorigenic conversion, promotion of genomic instability, and inhibition of hematopoietic differentiation.
Target Subcellular Location
Nucleus. Note=Expressed in nuclei of hepatocellular carcinoma cell line BEL-7402 cells.
Target Protein Families
MYCT1 family
Target Tissue Specificity
Down-regulated in gastric cancer tissues.
Target Synonyms
1110020B04Rik; AI225941; AI642973; FLJ21269; MGC156309; MGC156310; MTLC; Mtmc1; Myc target 1; Myc target in myeloid cells protein 1; Myc target protein 1; Myct1; MYCT1_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
