Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Myeloperoxidase (MPO) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against Myeloperoxidase (MPO) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of rat bone marrow using Myeloperoxidase (MPO) Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-13001A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Myeloperoxidase (MPO) |
| Target Synonyms | MPO; Myeloperoxidase (MPO) | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 606-745 of human Myeloperoxidase (MPO) (NP_000241.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPLLACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMSNSYPRDFVNCSTLPALNLASWREAS | Uniprot ID | P05164 |
Uniprot Id
P05164
Target Species
Human
Target Name
MPO
Target Full Name
Myeloperoxidase
Target Function
Part of the host defense system of polymorphonuclear leukocytes. It is responsible for microbicidal activity against a wide range of organisms. In the stimulated PMN, MPO catalyzes the production of hypohalous acids, primarily hypochlorous acid in physiologic situations, and other toxic intermediates that greatly enhance PMN microbicidal activity.
Target Involvement
Myeloperoxidase deficiency (MPOD)
Target Subcellular Location
Lysosome.
Target Protein Families
Peroxidase family, XPO subfamily
Target Synonyms
MPO; Myeloperoxidase (MPO)
Target Background
Myeloperoxidase (MPO) is a heme protein synthesized during myeloid differentiation that constitutes the major component of neutrophil azurophilic granules. Produced as a single chain precursor, myeloperoxidase is subsequently cleaved into a light and heavy chain. The mature myeloperoxidase is a tetramer composed of 2 light chains and 2 heavy chains. This enzyme produces hypohalous acids central to the microbicidal activity of neutrophils.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
