Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYF6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with MYF6 using MYF6 Rabbit pAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-05161A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYF6 |
| Target Synonyms | CNM3; MRF4; myf-6; bHLHc4; MYF6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with MYF6 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 80-180 of human MYF6 (NP_002460.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL | Uniprot ID | P23409 |
Uniprot Id
P23409
Target Species
Human
Target Name
MYF6
Target Full Name
Myogenic factor 6
Target Function
Involved in muscle differentiation (myogenic factor). Induces fibroblasts to differentiate into myoblasts. Probable sequence specific DNA-binding protein.
Target Involvement
Myopathy, centronuclear, 3 (CNM3)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Skeletal muscle.
Target Synonyms
bHLHc4; Class C basic helix-loop-helix protein 4; CNM3; HERCULIN; MRF4; Muscle-regulatory factor 4; Muscle-specific regulatory factor 4; Myf-6; Myf6; MYF6_HUMAN; myogenic factor 6 (herculin); Myogenic factor 6
Target Background
The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
