Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MYH1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-12757A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH1 |
| Target Synonyms | MYHa; HEL71; MYHSA1; MyHC-2x; MyHC-2X/D; MYH1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MYH1 (NP_005954.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSDSEMAIFGEAAPFLRKSERERIEAQNKPFDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEP | Uniprot ID | P12882 |
Uniprot Id
P12882
Target Species
Human
Target Name
MYH1
Target Full Name
Myosin-1
Target Function
Muscle contraction.
Target Subcellular Location
Cytoplasm, myofibril. Note=Thick filaments of the myofibrils.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Synonyms
adult 1; MYH1; MYH1_HUMAN; MyHC-2x; MyHC-IIx/d; Myosin heavy chain 1; Myosin heavy chain 2x; Myosin heavy chain; Myosin heavy chain IIx/d; Myosin-1; skeletal muscle
Target Background
Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. Myosin heavy chains are encoded by a multigene family. In mammals at least 10 different myosin heavy chain (MYH) isoforms have been described from striated, smooth, and nonmuscle cells. These isoforms show expression that is spatially and temporally regulated during development.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
