-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYH10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09242A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH10 |
| Target Synonyms | NMMHCB; NMMHC-IIB; MYH10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, NIH/3T3, Rat brain, HepG2, HT-29, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1908-2007 of human MYH10 (NP_001242941.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSREVSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE | Uniprot ID | P35580 |
Uniprot Id
P35580
Target Species
Human
Target Name
MYH10
Target Full Name
Myosin-10
Target Function
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2. During cell spreading, plays an important role in cytoskeleton reorganization, focal contacts formation (in the central part but not the margins of spreading cells), and lamellipodial extension; this function is mechanically antagonized by MYH9.
Target Involvement
Associated with severe intellectual disability, microcephaly, and feeding difficulties as well as cerebral atrophy.
Target Subcellular Location
Cell projection, lamellipodium. Note=Colocalizes with MCC at the leading edge of migrating cells.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
Isoform 1 is expressed in cerebellum and spinal chord. Isoform 2 is expressed in cerebrum and retina. Isoform 3 is expressed in the cerebrum and to a much lower extent in cerebellum.
Target Synonyms
Cellular myosin heavy chain; Cellular myosin heavy chain type B; Cellular myosin heavy chain type B type B; MGC134913; MGC134914; MYH 10; Myh10; MYH10_HUMAN; Myosin 10; Myosin heavy chain 10; Myosin heavy chain 10 non muscle; Myosin heavy chain; Myosin heavy chain non muscle 11b; Myosin heavy chain nonmuscle IIb; Myosin heavy chain nonmuscle type B; Myosin heavy polypeptide 10 non muscle; Myosin-10; Myosin10; NMMHC B; NMMHC II b; NMMHC II-b; NMMHC IIB; NMMHC-B; NMMHC-IIB; NMMHCB; Non muscle myosin heavy chain B; Non muscle myosin heavy chain IIB; Non muscle myosin II heavy chain B; non-muscle IIb; Non-muscle myosin heavy chain B; Non-muscle myosin heavy chain IIb; Nonmuscle myosin heavy chain B; Nonmuscle myosin heavy chain IIB; Nonmuscle myosin II heavy chain B; Nonmuscle myosin IIB; type B
Target Background
This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification