Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human MYH13 (NP_003793.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYH13 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human MYH13 (NP_003793.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05535A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH13 |
| Target Synonyms | MyHC-eo; MyHC-IIL; MYH13 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1320 of human MYH13 (NP_003793.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EALSKSKSNIERTCRTVEDQFSEIKAKDEQQTQLIHDLNMQKARLQTQNGELSHRVEEKESLISQLTKSKQALTQQLEELK | Uniprot ID | Q9UKX3 |
Uniprot Id
Q9UKX3
Target Species
Human
Target Name
MYH13
Target Full Name
Myosin-13
Target Function
Fast twitching myosin mediating the high-velocity and low-tension contractions of specific striated muscles.
Target Subcellular Location
Cytoplasm, myofibril. Note=Thick filaments of the myofibrils.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
Specifically expressed in extraocular and laryngeal muscles.
Target Synonyms
MYH13; Myosin-13; Myosin heavy chain 13; Myosin heavy chain; skeletal muscle; extraocular; MyHC-EO; Myosin heavy chain; skeletal muscle; laryngeal; MyHC-IIL; Superfast myosin
Target Background
Predicted to enable microfilament motor activity. Predicted to be involved in muscle contraction. Predicted to act upstream of or within cellular response to starvation. Located in extracellular exosome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
