Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH2 (NP_001093582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYH2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH2 (NP_001093582.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12174A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH2 |
| Target Synonyms | IBM3; CMYP6; MYH2A; MYPOP; MYHSA2; MYHas8; MyHC-2A; MyHC-IIa; MYH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse skeletal muscle, Rat skeletal muscle, U-2 OS | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MYH2 (NP_001093582.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLR | Uniprot ID | Q9UKX2 |
Uniprot Id
Q9UKX2
Target Species
Human
Target Name
MYH2
Target Full Name
Myosin-2
Target Function
Muscle contraction. Required for cytoskeleton organization.
Target Involvement
Myopathy, proximal, and ophthalmoplegia (MYPOP)
Target Subcellular Location
Cytoplasm, myofibril. Note=Thick filaments of the myofibrils.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Synonyms
adult 2; Fast 2a myosin heavy chain; IBM3; Inclusion body myopathy 3, autosomal dominant; MYH2; MYH2_HUMAN; MYH2A; MYHas8; MyHC IIa; MyHC-2a; MyHC-IIa; MYHSA2; Myosin heavy chain 2; Myosin heavy chain 2a; Myosin heavy chain; Myosin heavy chain IIa; Myosin heavy chain skeletal muscle adult 2; Myosin heavy polypeptide 2 skeletal muscle adult; Myosin-2; MYPOP; skeletal muscle; Type IIA myosin heavy chain
Target Background
Myosins are actin-based motor proteins that function in the generation of mechanical force in eukaryotic cells. Muscle myosins are heterohexamers composed of 2 myosin heavy chains and 2 pairs of nonidentical myosin light chains. This gene encodes a member of the class II or conventional myosin heavy chains, and functions in skeletal muscle contraction. This gene is found in a cluster of myosin heavy chain genes on chromosome 17. A mutation in this gene results in inclusion body myopathy-3. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
