Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 160-260 of human MYH6(NP_002462.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYH6 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 160-260 of human MYH6(NP_002462.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15741A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH6 |
| Target Synonyms | ASD3; MYHC; SSS3; CMH14; MYHCA; CMD1EE; alpha-MHC | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, 293F transfected with MYH6 (Human) | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 160-260 of human MYH6(NP_002462.2) . | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLA | Uniprot ID | P13533 |
Uniprot Id
P13533
Target Species
Human
Target Name
MYH6
Target Full Name
Myosin-6
Target Function
Muscle contraction.
Target Involvement
Atrial septal defect 3 (ASD3); Cardiomyopathy, familial hypertrophic 14 (CMH14); Cardiomyopathy, dilated 1EE (CMD1EE); Sick sinus syndrome 3 (SSS3)
Target Subcellular Location
Cytoplasm, myofibril. Note=Thick filaments of the myofibrils.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Research Area
Signal Transduction
Target Synonyms
cardiac muscle alpha isoform; MYH6; MYH6_HUMAN; MYHC; MyHC-alpha; MyHC-beta ; MYHCA; MYHCB; Myosin heavy chain 6; Myosin heavy chain; Myosin heavy chain cardiac muscle alpha isoform; Myosin heavy chain cardiac muscle beta isoform; Myosin-6
Target Background
Cardiac muscle myosin is a hexamer consisting of two heavy chain subunits, two light chain subunits, and two regulatory subunits. This gene encodes the alpha heavy chain subunit of cardiac myosin. The gene is located approximately 4kb downstream of the gene encoding the beta heavy chain subunit of cardiac myosin. Mutations in this gene cause familial hypertrophic cardiomyopathy and atrial septal defect 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
