Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1240-1340 of human MYH7(NP_000248.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against MYH7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1240-1340 of human MYH7(NP_000248.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
Western blot analysis of lysates from wild type (WT) and 293T transfected with MYH7 Rabbit pAb, using MYH7 at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 20s.
| Cat.No | ADA-08289A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH7 |
| Target Synonyms | CMH1; MPD1; SPMD; SPMM; CMD1S; MYHCB; CMYP7A; CMYP7B; MYH7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T transfected with MYH7 (Human) | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1240-1340 of human MYH7(NP_000248.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDC | Uniprot ID | P12883 |
Uniprot Id
P12883
Target Species
Human
Target Name
MYH7
Target Full Name
Myosin-7
Target Function
Myosins are actin-based motor molecules with ATPase activity essential for muscle contraction. Forms regular bipolar thick filaments that, together with actin thin filaments, constitute the fundamental contractile unit of skeletal and cardiac muscle.
Target Involvement
Cardiomyopathy, familial hypertrophic 1 (CMH1); Myopathy, myosin storage, autosomal dominant (MSMA); Scapuloperoneal myopathy MYH7-related (SPMM); Cardiomyopathy, dilated 1S (CMD1S); Myopathy, distal, 1 (MPD1); Myopathy, myosin storage, autosomal recessive (MSMB); Left ventricular non-compaction 5 (LVNC5)
Target Subcellular Location
Cytoplasm, myofibril. Cytoplasm, myofibril, sarcomere.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
Both wild type and variant Gln-403 are detected in skeletal muscle (at protein level).
Target Research Area
Signal Transduction
Target Synonyms
Beta myosin heavy chain; cardiac muscle beta isoform; CMD1S; CMH1; MPD1; MYH7; MYH7_HUMAN; Myhc slow; MyHC-beta; MyHC-slow; MYHCB; Myopathy, distal 1; Myosin heavy chain (AA 1-96); Myosin heavy chain 7; Myosin heavy chain; Myosin heavy chain slow isoform; Myosin heavy chain, cardiac muscle beta isoform; Myosin, heavy chain 7, cardiac muscle, beta; Myosin, heavy polypeptide 7, cardiac muscle, beta; Myosin-7; Rhabdomyosarcoma antigen MU RMS 40.7A; SPMD; SPMM
Target Background
Muscle myosin is a hexameric protein containing 2 heavy chain subunits, 2 alkali light chain subunits, and 2 regulatory light chain subunits. This gene encodes the beta (or slow) heavy chain subunit of cardiac myosin. It is expressed predominantly in normal human ventricle. It is also expressed in skeletal muscle tissues rich in slow-twitch type I muscle fibers. Changes in the relative abundance of this protein and the alpha (or fast) heavy subunit of cardiac myosin correlate with the contractile velocity of cardiac muscle. Its expression is also altered during thyroid hormone depletion and hemodynamic overloading. Mutations in this gene are associated with familial hypertrophic cardiomyopathy, myosin storage myopathy, dilated cardiomyopathy, and Laing distal myopathy.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
