-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYH9 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1860-1960 of human MYH9(NP_002464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against MYH9 was raised in Rabbit using the recombinant Protein corresponding to a sequence within amino acids 1860-1960 of human MYH9(NP_002464.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
| Cat.No | ADA-08400A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYH9 |
| Target Synonyms | MHA; FTNS; EPSTS; BDPLT6; DFNA17; MATINS; NMMHCA; NMHC-II-A; NMMHC-IIA; MYH9 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant Protein corresponding to a sequence within amino acids 1860-1960 of human MYH9(NP_002464.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QYKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNKLRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE | Uniprot ID | P35579 |
Uniprot Id
P35579
Target Species
Human
Target Name
MYH9
Target Full Name
Myosin-9
Target Function
Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Required for cortical actin clearance prior to oocyte exocytosis. Promotes cell motility in conjunction with S100A4. During cell spreading, plays an important role in cytoskeleton reorganization, focal contact formation (in the margins but not the central part of spreading cells), and lamellipodial retraction; this function is mechanically antagonized by MYH10.
Target Involvement
May-Hegglin anomaly (MHA); Sebastian syndrome (SBS); Fechtner syndrome (FTNS); Epstein syndrome (EPSTNS); Deafness, autosomal dominant, 17 (DFNA17); Macrothrombocytopenia and progressive sensorineural deafness (MPSD)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex. Cytoplasmic vesicle, secretory vesicle, Cortical granule.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
In the kidney, expressed in the glomeruli. Also expressed in leukocytes.
Target Synonyms
BDPLT 6; BDPLT6; Cellular myosin heavy chain; Cellular myosin heavy chain type A; DFNA 17; DFNA17; EPSTS; FTNS; MGC104539; MHA; MYH 2A; MYH 9; MYH2A; MYH9; MYH9_HUMAN; MYHas8; MyHC 2A; MyHC IIa; MyHC2A; MyHCIIa; MYHSA 2; MYHSA2; Myosin 9; Myosin heavy chain 9; Myosin heavy chain 9 non muscle; Myosin heavy chain; Myosin heavy chain non muscle IIa; Myosin heavy chain nonmuscle IIa; Myosin heavy polypeptide 2; Myosin heavy polypeptide 9 non muscle; Myosin-9; Myosin9; NMHC II A; NMMHC A; NMMHC II a; NMMHC II-a; NMMHC IIA; NMMHC-A; NMMHC-IIA; NMMHCA; Non muscle myosin heavy chain A; Non muscle myosin heavy chain; Non muscle myosin heavy chain II A; Non muscle myosin heavy polypeptide 9; non-muscle IIa; Non-muscle myosin heavy chain A; Non-muscle myosin heavy chain IIa; Nonmuscle myosin heavy chain A; Nonmuscle myosin heavy chain II A; type A
Target Background
This gene encodes a conventional non-muscle myosin; this protein should not be confused with the unconventional myosin-9a or 9b (MYO9A or MYO9B). The encoded protein is a myosin IIA heavy chain that contains an IQ domain and a myosin head-like domain which is involved in several important functions, including cytokinesis, cell motility and maintenance of cell shape. Defects in this gene have been associated with non-syndromic sensorineural deafness autosomal dominant type 17, Epstein syndrome, Alport syndrome with macrothrombocytopenia, Sebastian syndrome, Fechtner syndrome and macrothrombocytopenia with progressive sensorineural deafness.
Notification