-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYL9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against MYL9 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-11263A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYL9 |
| Target Synonyms | LC20; MLC2; MRLC1; MYRL2; MLC-2C; MMIHS4; MYL9 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat heart, C2C12, Mouse lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MYL9 (NP_006088.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPE | Uniprot ID | P24844 |
Uniprot Id
P24844
Target Species
Human
Target Name
MYL9
Target Full Name
Myosin regulatory light polypeptide 9
Target Function
Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion. In myoblasts, may regulate PIEZO1-dependent cortical actomyosin assembly involved in myotube formation.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cell cortex.
Target Tissue Specificity
Smooth muscle tissues and in some, but not all, nonmuscle cells.
Target Research Area
Cancer
Target Synonyms
20 kDa myosin light chain; Human 20kDa myosin light chain (MLC2) mRNA complete cds; LC20; MGC3505 ; MLC 2 ; MLC-2C; MLC2 ; MLY 9; MRLC1 ; MYL9; MYL9_HUMAN; Myosin light chain 9 regulatory; Myosin light polypeptide 9 regulatory; myosin regulatory light chain 1; Myosin regulatory light chain 2; Myosin regulatory light chain 2 smooth muscle isoform; Myosin regulatory light chain 9; Myosin regulatory light chain MRLC1; Myosin regulatory light polypeptide 9; Myosin RLC; Myosin vascular smooth muscle light chain 2; MYRL2 ; OTTHUMP00000030857; smooth muscle isoform
Target Background
Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded protein binds calcium and is activated by myosin light chain kinase. Two transcript variants encoding different isoforms have been found for this gene.
Notification