-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYO10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYO10 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09014A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYO10 |
| Target Synonyms | MyoX; MYO10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 845-944 of human MYO10 (NP_036466.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EAELRAQQEEETRKQQELEALQKSQKEAELTRELEKQKENKQVEEILRLEKEIEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLES | Uniprot ID | Q9HD67 |
Uniprot Id
Q9HD67
Target Species
Human
Target Name
MYO10
Target Full Name
Unconventional myosin-X
Target Function
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. MYO10 binds to actin filaments and actin bundles and functions as plus end-directed motor. The tail domain binds to membranous compartments containing phosphatidylinositol 3,4,5-trisphosphate or integrins, and mediates cargo transport along actin filaments. Regulates cell shape, cell spreading and cell adhesion. Stimulates the formation and elongation of filopodia. May play a role in neurite outgrowth and axon guidance. In hippocampal neurons it induces the formation of dendritic filopodia by trafficking the actin-remodeling protein VASP to the tips of filopodia, where it promotes actin elongation. Plays a role in formation of the podosome belt in osteoclasts.; Functions as a dominant-negative regulator of isoform 1, suppressing its filopodia-inducing and axon outgrowth-promoting activities. In hippocampal neurons, it increases VASP retention in spine heads to induce spine formation and spine head expansion.
Target Subcellular Location
Cytoplasm, cytosol. Cell projection, lamellipodium. Cell projection, ruffle. Cytoplasm, cytoskeleton. Cell projection, filopodium tip. Cytoplasm, cell cortex. Cell projection, filopodium membrane; Peripheral membrane protein. Note=May be in an inactive, monomeric conformation in the cytosol. Detected in cytoplasmic punctae and in cell projections. Colocalizes with actin fibers. Undergoes forward and rearward movements within filopodia. Interacts with microtubules.
Target Protein Families
TRAFAC class myosin-kinesin ATPase superfamily, Myosin family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
AW048724; D15Ertd600e; FLJ10639; FLJ21066; FLJ22268; FLJ43256; KIAA0799; MGC131988; mKIAA0799; MYO10; MYO10_HUMAN; Myosin X; Myosin-X; OTTMUSP00000022066; Unconventional myosin 10; Unconventional myosin X; Unconventional myosin-10
Target Background
This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.
Notification