-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYOM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MYOM2 (NP_003961.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYOM2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MYOM2 (NP_003961.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10620A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYOM2 |
| Target Synonyms | TTNAP; MYOM2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human MYOM2 (NP_003961.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRASSQTSLGGTICRVCAKRVSTQEDEEQENRSRYQSLVAAYGEAKRQRFLSELAHLEEDVHLARSQARDKLDKYAIQQMMEDKLAWERHTFEERISRAPEILVRLRSHTVWERMSVKLCFTVQGFPTPVVQWYKDGSLICQAAEP | Uniprot ID | P54296 |
Uniprot Id
P54296
Target Species
Human
Target Name
MYOM2
Target Full Name
Myomesin-2
Target Function
Major component of the vertebrate myofibrillar M band. Binds myosin, titin, and light meromyosin. This binding is dose dependent.
Target Subcellular Location
Cytoplasm, myofibril, sarcomere, M line.
Target Synonyms
165 kDa connectin associated protein; 165 kDa connectin-associated protein; 165 kDa titin associated protein; 165 kDa titin-associated protein; M band protein; M protein; M-protein; MYOM 2; MYOM2; MYOM2_HUMAN; Myomesin (M protein) 2 (165kD); Myomesin (M protein) 2 165kDa; Myomesin (M protein) 2; Myomesin 2; Myomesin family member 2; Myomesin-2; Titin associated protein 165 kD; Titin associated protein; TTNAP
Target Background
The giant protein titin, together with its associated proteins, interconnects the major structure of sarcomeres, the M bands and Z discs. The C-terminal end of the titin string extends into the M line, where it binds tightly to M-band constituents of apparent molecular masses of 190 kD and 165 kD. The predicted MYOM2 protein contains 1, 465 amino acids. Like MYOM1, MYOM2 has a unique N-terminal domain followed by 12 repeat domains with strong homology to either fibronectin type III or immunoglobulin C2 domains. Protein sequence comparisons suggested that the MYOM2 protein and bovine M protein are identical.
Notification