-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYOZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-299 of human MYOZ1 (NP_067068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYOZ1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 180-299 of human MYOZ1 (NP_067068.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00644A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYOZ1 |
| Target Synonyms | CS-2; FATZ; MYOZ; MYOZ1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, A-549, BxPC-3, DU145, Mouse liver, Mouse skeletal muscle, Mouse thymus, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 180-299 of human MYOZ1 (NP_067068.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFKTYISPWERAMGVDPQQKMELGIDLLAYGAKAELPKYKSFNRTAMPYGGYEKASKRMTFQMPKFDLGPLLSEPLVLYNQNLSNRPSFNRTPIPWLSSGEPVDYNVDIGIPLDGETEEL | Uniprot ID | Q9NP98 |
Uniprot Id
Q9NP98
Target Species
Human
Target Name
MYOZ1
Target Full Name
Myozenin-1
Target Function
Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.
Target Subcellular Location
Nucleus. Cell projection, pseudopodium. Note=Localized to the nucleus and pseudopodia of undifferentiated cells and detected throughout the myotubes of differentiated cells. Colocalizes with ACTN2, FLNC and MYOT at the Z-lines of skeletal muscle.
Target Protein Families
Myozenin family
Target Tissue Specificity
Expressed primarily in skeletal muscle. Detected at lower levels in heart, prostate and pancreas.
Target Synonyms
actinin- and telethonin-binding protein; Calsarcin 2; Calsarcin-2; CS 2; FATZ; Filamin, actinin and telethonin binding protein; Filamin-; MYOZ; MYOZ1; MYOZ1_HUMAN; Myozenin-1; Protein FATZ
Target Background
The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.
Notification