Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MYT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-820 of human MYT1 (NP_004526.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MYT1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 650-820 of human MYT1 (NP_004526.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10943A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MYT1 |
| Target Synonyms | MTF1; MYTI; NZF2; PLPB1; ZC2H2C1; ZC2HC4A; C20orf36; MYT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Rat kidney, Rat liver, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 650-820 of human MYT1 (NP_004526.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KPQDLPSKSVDIEVDENGTLDLSMHKHRKRENAFPSSSSCSSSPGVKSPDASQRHSSTSAPSSSMTSPQSSQASRQDEWDRPLDYTKPSRLREEEPEESEPAAHSFASSEADDQEVSEENFEERKYPGEVTLTNFKLKFLSKDIKKELLTCPTPGCDGSGHITGNYASHRS | Uniprot ID | Q01538 |
Uniprot Id
Q01538
Target Species
Human
Target Name
MYT1
Target Full Name
Myelin transcription factor 1
Target Function
Binds to the promoter region of genes encoding proteolipid proteins of the central nervous system. May play a role in the development of neurons and oligodendroglia in the CNS. May regulate a critical transition point in oligodendrocyte lineage development by modulating oligodendrocyte progenitor proliferation relative to terminal differentiation and up-regulation of myelin gene transcription.
Target Subcellular Location
Nucleus.
Target Protein Families
MYT1 family
Target Tissue Specificity
Mostly in developing nervous system. Expressed in neural progenitors and oligodendrocyte lineage cells. More highly expressed in oligodendrocyte progenitors than in differentiated oligodendrocytes.
Target Research Area
Developmental Biology
Target Synonyms
C20orf36; KIAA0835; KIAA1050; MTF1; Myelin transcription factor 1; Myelin transcription factor I; MYT1; MYT1_HUMAN; MyTI; PLPB1; Proteolipid protein-binding protein
Target Background
The protein encoded by this gene is a member of a family of neural specific, zinc finger-containing DNA-binding proteins. The protein binds to the promoter regions of proteolipid proteins of the central nervous system and plays a role in the developing nervous system.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
