Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MZB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human MZB1 (NP_057543.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MZB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human MZB1 (NP_057543.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-05611A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MZB1 |
| Target Synonyms | PACAP; pERp1; MEDA-7; MZB1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-189 of human MZB1 (NP_057543.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL | Uniprot ID | Q8WU39 |
Uniprot Id
Q8WU39
Target Species
Human
Target Name
MZB1
Target Full Name
Marginal zone B- and B1-cell-specific protein
Target Function
Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity. Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.; Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
Target Subcellular Location
[Isoform 1]: Endoplasmic reticulum lumen. Secreted.; [Isoform 2]: Cytoplasm. Note=Diffuse granular localization in the cytoplasm surrounding the nucleus (PubMed:11350957).
Target Protein Families
MZB1 family
Target Tissue Specificity
Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in subcutaneous fat.
Target Synonyms
MZB1; Caspase 2 binding protein; FLJ32987; HSPC190; Marginal zone B and B1 cell specific protein; Marginal zone B- and B1-cell-specific protein; MEDA 7; MEDA-7; Mesenteric estrogen dependent adipose 7; Mesenteric estrogen-dependent adipose 7; Mesenteric oestrogen dependent adipose gene 7; MGC29506; Mzb1; MZB1_HUMAN; PACAP; pERp1; Plasma cell-induced ER protein 1; Plasma cell-induced resident endoplasmic reticulum protein; Plasma cell-induced resident ER protein; Proapoptotic caspase adapter protein
Target Background
Involved in positive regulation of cell population proliferation. Located in cytoplasm and extracellular region.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
