Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAGK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-210 of human NAGK (NP_060037.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAGK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 50-210 of human NAGK (NP_060037.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08935A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAGK |
| Target Synonyms | GNK; HSA242910; NAGK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A-431, Jurkat, Mouse brain, Rat kidney, SW480 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 50-210 of human NAGK (NP_060037.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIEELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV | Uniprot ID | Q9UJ70 |
Uniprot Id
Q9UJ70
Target Species
Human
Target Name
NAGK
Target Full Name
N-acetyl-D-glucosamine kinase
Target Function
Converts endogenous N-acetylglucosamine (GlcNAc), a major component of complex carbohydrates, from lysosomal degradation or nutritional sources into GlcNAc 6-phosphate. Involved in the N-glycolylneuraminic acid (Neu5Gc) degradation pathway: although human is not able to catalyze formation of Neu5Gc due to the inactive CMAHP enzyme, Neu5Gc is present in food and must be degraded. Also has ManNAc kinase activity.
Target Protein Families
Eukaryotic-type N-acetylglucosamine kinase family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
EC 2.7.1.59; GlcNAc kinase; GNK; HSA242910; N acetylglucosamine kinase; N-acetyl-D-glucosamine kinase; N-acetylglucosamine kinase; nagK; NAGK_HUMAN
Target Background
This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
