-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAP1L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NAP1L1 (NP_004528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAP1L1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NAP1L1 (NP_004528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01984A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAP1L1 |
| Target Synonyms | NRP; NAP1; NAP1L; NAP1L1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A375, LO2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human NAP1L1 (NP_004528.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEF | Uniprot ID | P55209 |
Uniprot Id
P55209
Target Species
Human
Target Name
NAP1L1
Target Full Name
Nucleosome assembly protein 1-like 1
Target Function
Histone chaperone that plays a role in the nuclear import of H2A-H2B and nucleosome assembly. Participates also in several important DNA repair mechanisms: greatly enhances ERCC6-mediated chromatin remodeling which is essential for transcription-coupled nucleotide excision DNA repair. Stimulates also homologous recombination (HR) by RAD51 and RAD54 which is essential in mitotic DNA double strand break (DSB) repair. Plays a key role in the regulation of embryonic neurogenesis. Promotes the proliferation of neural progenitors and inhibits neuronal differentiation during cortical development. Regulates neurogenesis via the modulation of RASSF10; regulates RASSF10 expression by promoting SETD1A-mediated H3K4 methylation at the RASSF10 promoter.; (Microbial infection) Positively regulates Epstein-Barr virus reactivation in epithelial cells through the induction of viral BZLF1 expression.; (Microbial infection) Together with human herpesvirus 8 protein LANA1, assists the proper assembly of the nucleosome on the replicated viral DNA.
Target Subcellular Location
Nucleus. Melanosome. Cytoplasm. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
Nucleosome assembly protein (NAP) family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
FLJ16112; hNRP; HSP22 like protein interacting protein; MGC23410; MGC8688; NAP 1; NAP 1 related protein; NAP 1L; NAP-1-related protein; NAP1; NAP1 L1; NAP1 related protein; NAP1L; Nap1l1; NAP1L1 protein; NP1L1_HUMAN; NRP; Nucleosome assembly protein 1 like 1; Nucleosome assembly protein 1-like 1; Nucleosome assembly protein I-related protein
Target Background
This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described.
Notification