Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAP1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human NAP1L1 (P55209) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NAP1L1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human NAP1L1 (P55209) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04275A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAP1L1 |
| Target Synonyms | NRP; NAP1; NAP1L; NAP1L1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, NIH/3T3, HT-29, Mouse spleen, SKOV3, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NAP1L1 (P55209). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ | Uniprot ID | P55209 |
Uniprot Id
P55209
Target Species
Human
Target Name
NAP1L1
Target Full Name
Nucleosome assembly protein 1-like 1
Target Function
Histone chaperone that plays a role in the nuclear import of H2A-H2B and nucleosome assembly. Participates also in several important DNA repair mechanisms: greatly enhances ERCC6-mediated chromatin remodeling which is essential for transcription-coupled nucleotide excision DNA repair. Stimulates also homologous recombination (HR) by RAD51 and RAD54 which is essential in mitotic DNA double strand break (DSB) repair. Plays a key role in the regulation of embryonic neurogenesis. Promotes the proliferation of neural progenitors and inhibits neuronal differentiation during cortical development. Regulates neurogenesis via the modulation of RASSF10; regulates RASSF10 expression by promoting SETD1A-mediated H3K4 methylation at the RASSF10 promoter.; (Microbial infection) Positively regulates Epstein-Barr virus reactivation in epithelial cells through the induction of viral BZLF1 expression.; (Microbial infection) Together with human herpesvirus 8 protein LANA1, assists the proper assembly of the nucleosome on the replicated viral DNA.
Target Subcellular Location
Nucleus. Melanosome. Cytoplasm. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Target Protein Families
Nucleosome assembly protein (NAP) family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
FLJ16112; hNRP; HSP22 like protein interacting protein; MGC23410; MGC8688; NAP 1; NAP 1 related protein; NAP 1L; NAP-1-related protein; NAP1; NAP1 L1; NAP1 related protein; NAP1L; Nap1l1; NAP1L1 protein; NP1L1_HUMAN; NRP; Nucleosome assembly protein 1 like 1; Nucleosome assembly protein 1-like 1; Nucleosome assembly protein I-related protein
Target Background
This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
