-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NAPSA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 321-420 of human NAPSA (NP_004842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against NAPSA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 321-420 of human NAPSA (NP_004842.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09672A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NAPSA |
| Target Synonyms | KAP; Kdap; NAP1; NAPA; SNAPA; NAPSA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 321-420 of human NAPSA (NP_004842.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PKLPAVSFLLGGVWFNLTAHDYVIQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQAQFPG | Uniprot ID | O96009 |
Uniprot Id
O96009
Target Species
Human
Target Name
NAPSA
Target Full Name
Napsin-A
Target Function
May be involved in processing of pneumocyte surfactant precursors.
Target Subcellular Location
Secreted.
Target Protein Families
Peptidase A1 family
Target Tissue Specificity
Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
Target Research Area
Cell Biology
Target Synonyms
Asp 4; ASP4; Aspartyl protease 4; KAP; Kdap; Kidney derived aspartic protease like protein; NAP1; NAPA; Napsa; NAPSA_HUMAN; Napsin 1; napsin A aspartic peptidase; Napsin A precursor; Napsin-1; Napsin-A; Pronapsin A; SNAPA; TA01/TA02
Target Background
This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.
Notification